PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo1G0039700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family Dof
Protein Properties Length: 255aa    MW: 27263.5 Da    PI: 8.0408
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo1G0039700genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof112.91.5e-352682360
          zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60
                     + l+cprC+s+ntkfCyynnys sqPryfCkaCrryWtkGGalrnvPvGg  rk k+
  Spipo1G0039700 26 GQPLRCPRCNSANTKFCYYNNYSRSQPRYFCKACRRYWTKGGALRNVPVGGR-RKAKR 82
                    67899********************************************975.55554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027015.2E-312881IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-212982IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.2332983IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103167IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MSKIGGEAFQ EIGRGKMQQR PQSQQGQPLR CPRCNSANTK FCYYNNYSRS QPRYFCKACR  60
RYWTKGGALR NVPVGGRRKA KRVQGSRPRL SLSNSAPDNA ASEGNTTPAS SPSPFGTDLL  120
FLSNGDLLGE LLPLPSPLPQ FSMISSQSVD DGGGHSPFTS PQSLPLFNSA GQNDLPGVDA  180
GMMAFTGSPA PWELLPSFPC HGGAITTSSG LGATEPSPSS SYWDSCWDDL VGFLLPDHED  240
RPPLPQPSPD ILLS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17583GRRKAKRVQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21340.15e-29Dof family protein